Cilp1 antibody

Author: ycyo

August undefined, 2024

Web(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your procurement list. View List. Remove. View more details on the supplier's website. Supplier provided information. Validations. None provided. Applications. WebProduct Details. This Human CILP ELISA Kit was designed for the quantitative measurement of Human CILP protein in serum, plasma, tissue homogenates. It is a …

TotalSeq™-C1043 anti-mouse CD74 (CLIP) Antibody

WebDetector antibody conjugate. Biotin. Label or dye. HRP . Gene aliases. CILP, CILP-1, HsT18872, UNQ602/PRO1188. Gene ID (Human) 8483. Gene symbol. CILP. UniProt ID (Human) O75339. Show Less . About This Kit. Human CILP-1 quantitates human CILP-1 in serum, plasma, supernatant. The assay will exclusively recognize both natural and … WebJun 1, 2005 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein … philly\u0027s best cheesesteaks

CILP-1 Antibody (NB100-41106): Novus Biologicals

WebNov 18, 2008 · The synthesis of cartilage intermediate layer protein (CILP), which was identified and purified from human articular cartilage ( Lorenzo et al., 1998 ), increases in early osteoarthrosis cartilage. By RT-PCR using human articular cartilage RNA and degenerate primers based on the amino acid sequence of CILP, and by screening a … WebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding … WebListed below are anti-CILP-1 antibodies from multiple suppliers. CILP-1 is a reported alias name for the human gene CILP, or 'cartilage intermediate layer protein'. The 1184-amino acid protein has a reported mass of 132,565 daltons. The cellular localization is predicted to be secreted. Glycosylation sites have been reported. philly\\u0027s best chicago

(NBP1-81667) CILP-1 Antibody - Novus Biologicals - CiteAb

Recombinant Anti-CILP antibody [EPR16303] - BSA and Azide free …

WebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage. WebPresident Trump commented on the possibility of a "COVID 4" relief bill and his desire to invest in the country's infrastructure. tsc incrementalWebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth … tsc industries materiality

"WebAntibody Testing Data (2) Application FIGURE 1/2 CLP1 Antibody (14746-1-AP) in WB Mouse testis tissue were subjected to SDS PAGE followed by western blot with 14746-1 … " - Cilp1 antibody

Cilp1 antibody

Anti-MHC Class II Antibody [6C6] (ab55152) - erpantech.com

WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - … WebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ...

Did you know?

WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - CILP1_HUMAN. Gene CILP Modification Unmodified View Product On Supplier's Website Request a Quote from Novus Biologicals.

Web购物车里没有产品. Anti-MHC Class II Antibody [6C6] (ab55152) 产品货号产品 WebNov 22, 2024 · CILP1 is an extracellular matrix (ECM) protein abundant in articular cartilage 6 and has been implicated in several diseases …

WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog.

WebJan 15, 2024 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the …

WebOct 28, 2011 · CILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensus site ( 7 ). The N-terminal of CILP-1 has been shown to bind to and inhibit TGFβ1 in vitro ( 8 … tsc in etown kyWebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and … tsc in elizabeth city ncWebOur CILP polyclonal antibodies are developed in Goat and Rabbit. Find the CILP antibody that fits your needs. Choose from 1 of 4 CILP antibodies, which have been validated in … philly\u0027s best downey caWebOct 8, 2024 · In mice, the amount of RV CILP1 was markedly higher after banding than after sham. Control patients had lower CILP1 serum levels than all other groups (p<0.001). CILP1 concentrations were higher in PH patients with maladaptive RV function than those with adaptive RV function (p<0.001), LV pressure overload (p<0.001), and DCM (p=0.003). philly\u0027s best columbia md menuWebThe CLP1 Antibody from MyBioSource.com is a Rabbit Polyclonal antibody to CLP1. This antibody recognizes Human, Mouse, and Rat antigen. The CLP1 Antibody has been … tsc in franklin indianaWebMar 21, 2024 · CILP (Cartilage Intermediate Layer Protein) is a Protein Coding gene. Diseases associated with CILP include Intervertebral Disc Disease and Osteoarthritis . … philly\u0027s best irvine caWebPolyclonal Antibody for studying CLIP1/CLIP170. Cited in 5 publications. Validated for Western Blotting. Highly specific and rigorously validated in-house, CLIP1/CLIP170 Antibody (CST #8977) is ready to ship. philly\u0027s best costa mesa